Skip to content

AMBA AXI · Module 2

The Write Path

Walk an AXI write end-to-end across the AW, W, and B channels — address, data with WSTRB and WLAST, and the single BRESP response that confirms the write landed.

The read path used two channels because the returning data was its own acknowledgement. A write has no returning data — so it needs three channels: AW (write address), W (write data), and B (write response). That third channel is the whole story of this chapter: because nothing comes back from a write except a confirmation, the B channel exists to tell the manager the write landed, and whether it succeeded. We'll walk a write end-to-end, meet the two write-only details the read didn't have — WSTRB byte strobes and a single BRESP — and see why a write that ignores B is a real silicon bug. The deep channel-dependency and deadlock rules are still Module 3; here we follow the path.

1. A Write Is Three Channels — and Why

A write decomposes into three one-directional channels:

  • AW (manager → subordinate): the write address and attributes — where and how much.
  • W (manager → subordinate): the write data, the byte strobes (WSTRB), and WLAST on the final beat — what to write.
  • B (subordinate → manager): a single response (BRESP) — did it land, and was it clean?

Compare to the read: a read's answer (the data on R) doubles as its acknowledgement, so two channels suffice. A write sends data out and gets nothing back but a verdict — so it needs a dedicated B channel to carry that verdict. The presence of B is the structural difference between a write and a read, and the reason is simply that you cannot confirm a write by its (non-existent) return data.

2. The Write Address Channel (AW)

AW carries the write's intent, mirroring AR on the read side: the write address plus AWLEN (how many beats), AWSIZE (beat width), AWBURST (burst type), AWID (transaction ID), and protection/cache attributes. One AW handshake launches one write transaction, which may carry many beats of data on W.

As on the read side, AW carries no data — it is purely the request. And one AW can describe a whole burst: AWLEN says how many W beats this single address will be followed by.

3. The Write Data Channel (W) — and WSTRB

W carries the payload, and it introduces the first thing the read path didn't have — byte strobes:

  • WDATA — the data for this beat.
  • WSTRBbyte-lane strobes: one bit per byte of WDATA, marking which bytes in this beat are actually written. This is how AXI does partial / sparse writes — writing a single byte into a wide bus means asserting one strobe bit and leaving the rest deasserted. A read has no equivalent, because a read always returns full beats; only a write can be partial.
  • WLAST — asserted on the final W beat, marking the end of the write data, exactly as RLAST did for reads.

So the manager streams W beats, each selecting its valid bytes with WSTRB, and raises WLAST on the last one. WSTRB is worth flagging now because forgetting it — or driving it wrong — silently corrupts memory in a way that's invisible until something reads the bytes back.

4. The Write Response Channel (B)

B is the channel a write cannot do without. After the subordinate has accepted the write data, it drives one response on B:

  • BRESP — the response code (OKAY / EXOKAY / SLVERR / DECERR) for the whole write transaction. Note one response per write — unlike the read's per-beat RRESP — because a write is acknowledged as a single completed operation, not beat by beat.
  • BID — identifies which transaction this response belongs to (matching the AWID), so responses can be paired with their writes even when several are outstanding.

The manager accepts the response with BREADY, and only then is the write complete. A write isn't "done" when the last data beat goes out — it's done when B comes back confirming the subordinate took it.

The manager sends one write address on AW, then four write-data beats on W with WLAST on the fourth, and the subordinate returns a single B response confirming the write.A burst write — AW, four W beats, one BManagerSubordinateAW — write address(AWLEN = 3 → 4beats)W — beat 0 (WDATA,WSTRB)W — beat 1 (WDATA,WSTRB)W — beat 2 (WDATA,WSTRB)W — beat 3 (WDATA,WSTRB, WLAST)B — single response(BRESP)
Figure 1 — a 4-beat burst write, time downward. One AW handshake launches the write; the manager then streams four W beats (each with WSTRB byte-enables), asserting WLAST on the last; finally the subordinate returns a single B response (BRESP) confirming the whole write. Three channels, one transaction.

5. A Single-Beat Write, End to End

Drop to the cycle level for the simplest write — one beat — and watch all three handshakes in sequence.

valid / ready (per channel)

AXI4 single-beat write — AW → W → B

12 cycles
AXI write waveform: awvalid and awready high transfer the address; wvalid, wready and wlast high transfer the single data beat; later bvalid, bready and bresp=OKAY transfer the response, completing the write.address (AW)address (AW)data (W)data (W)response (B)response (B)awaddr acceptedawaddr acceptedwdata acceptedwdata acceptedbresp acceptedbresp acceptedaclkawvalidawreadyawaddrXX0x800x80XXXXXXXXwvalidwreadywdataXXXX0xDE0xDEXXXXXXwlastbvalidbreadybrespXXXXXXXXOKOKXXt0t1t2t3t4t5t6t7t8t9t10t11
Address accepted on AW, data (wlast=1) accepted on W, then the subordinate's bresp=OKAY accepted on B. Only after B does the manager know the write landed.
Figure 2 — a single-beat AXI write. The address transfers on the AW handshake (awvalid & awready); the data transfers on the W handshake (wvalid & wready, with wlast=1); then the subordinate returns the response on the B handshake (bvalid & bready, bresp=OKAY). The write is complete only when B is accepted.

Walking it: the manager drives awvalid with the address and the subordinate raises awready — the address is accepted. The manager drives wvalid with wdata, wstrb, and wlast=1, and the subordinate raises wready — the data is accepted. After it has taken the data, the subordinate drives bvalid with bresp, the manager accepts with bready — the response is accepted and the write is now complete. Three handshakes, in order, and the transaction isn't finished until the third.

6. The Write Lifecycle

At the transaction level a write is a short sequence with a burst loop in the middle, ending on B:

Write lifecycle: idle, then address accepted on AW, then W beats stream in a loop until WLAST, then the subordinate returns a single B response, and accepting B completes the write.no — more beatsyesIdleAddress accepted (AWhandshake)W beat sent (WDATA +WSTRB)WLAST on thisbeat?Subordinate returnssingle B responseB accepted →write complete
Figure 3 — the write lifecycle. After the AW handshake the manager streams W beats, looping until the beat carrying WLAST; the subordinate then returns a single B response, and only accepting B completes the write. A single-beat write takes the W loop exactly once.

A write monitor follows exactly this shape — capture the address on AW, collect W beats until WLAST, then pair the single B response:

Azvya Education Pvt. Ltd.VLSI Mentor
Snippet
// Conceptual — reconstruct one write transaction from its three channels.
if (awvalid && awready)               // AW handshake: write launched
  addr = awaddr;
 
if (wvalid && wready) begin           // each W handshake: one data beat
  beats.push_back('{wdata, wstrb});   // capture data + which bytes are valid
  if (wlast) data_done = 1;           // WLAST ends the data phase
end
 
if (bvalid && bready)                 // B handshake: the verdict
  complete_write(addr, beats, bresp); // pair the single response to the write

Note the asymmetry with the read monitor: a read completed on RLAST; a write isn't complete until the separate B handshake, which is the extra step the third channel forces.

7. Read vs Write — Why the Extra Channel

The cleanest way to lock this in is to put the two paths beside each other. They share the AW/AR request idea and the data-with-LAST idea; they differ entirely in how completion is signalled.

Read versus write paths: a read uses AR and R, with completion carried by the returning data; a write uses AW, W, and B, where B is a separate channel carrying the single response because a write returns no data.READ — 2 channelscompletion rides on the dataAR — address outR — data back + RLAST(RRESP per beat)data IS the acknowledgementWRITE — 3 channelsneeds a separate verdictAW — address outW — data out + WLAST → B— single BRESPB confirms it landed12
Figure 4 — read versus write, side by side. A read's completion rides on its returning data (RLAST on R), so two channels suffice. A write sends data out and gets nothing back but a verdict, so it needs a third channel — B — to carry the single response. The extra channel is not overhead; it is the only way to confirm a write.

8. Common Misconceptions

9. Debugging Insight

10. Verification Insight

11. Interview Questions

12. Summary

A write is three channels because it returns no data: the manager launches it on AW (address + AWLEN), streams the payload on W (data + WSTRB byte strobes + WLAST), and the subordinate confirms with one response on B (BRESP, matched by BID). The write is complete only when B is accepted — not when the last data beat goes out — and that third channel exists precisely because, unlike a read, there is no returning data to serve as the acknowledgement.

Two write-only details separate this path from the read: WSTRB, which selects the valid bytes per beat and enables partial writes (mis-drive it and memory corrupts silently), and the single BRESP on B, which a manager must actually check — SLVERR/DECERR mean the write didn't land. Read a write off a waveform as three handshakes ending on B; reconstruct it as capture address, collect beats to WLAST, pair the B response, honour WSTRB; and debug it by always looking at B. Reads and writes now both walk end-to-end — next we make explicit why keeping these channels independent is what makes AXI fast.

13. What Comes Next

You've followed both a read and a write end-to-end. Module 2 now turns to the property that makes those channels powerful:

Previous: 2.2 — The Read Path. For the broader protocol catalog, see the AMBA family overview doc.